PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01011.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 325aa    MW: 37425.5 Da    PI: 6.3186
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01011.1_g00006.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.98e-5371351128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyW 83 
                              +ppGfrFhPt+eelv +yL +k+++ k  l +vi e+d+yk+ePwd+++     ++e++ewyfFs++d+ky+tg+r+nrat++g+W
  Rsa1.0_01011.1_g00006.1   7 MPPGFRFHPTEEELVGYYLDRKINSMKSAL-DVIVEIDLYKMEPWDIQArctLGYEEQNEWYFFSHKDRKYPTGTRTNRATAAGFW 91 
                              79*************************887.99**************953432234677*************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              katg+dk+vls k++++g++ktLv+ykgrap+g+k+dW+mheyrl
  Rsa1.0_01011.1_g00006.1  92 KATGRDKAVLS-KNSVIGMRKTLVYYKGRAPNGRKSDWIMHEYRL 135
                              ***********.8889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-594156IPR003441NAC domain
PROSITE profilePS5100557.1727156IPR003441NAC domain
PfamPF023657.5E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009741Biological Processresponse to brassinosteroid
GO:0045491Biological Processxylan metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0050832Biological Processdefense response to fungus
GO:0071365Biological Processcellular response to auxin stimulus
GO:0090059Biological Processprotoxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MDNIMHMPPG FRFHPTEEEL VGYYLDRKIN SMKSALDVIV EIDLYKMEPW DIQARCTLGY  60
EEQNEWYFFS HKDRKYPTGT RTNRATAAGF WKATGRDKAV LSKNSVIGMR KTLVYYKGRA  120
PNGRKSDWIM HEYRLQNSEL APVQEEGWVV CRAFRKPIPN QRPLGYEPWQ SQLYHVDSSN  180
NYSSSATMNT SHHIGASSSS HNLNQMKMSN NHYNANNVSS SMHQYGNIEL PQLDSPSLSP  240
SLGTNKDQNE GFEQEEEKNF NCVDWRTLDS LLETQVTHPQ NPNALMSSFE TQSYNPAQSF  300
PSMLQNYNHE VETNIHDSLG CFPDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-50515613168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00017PBMTransfer from AT1G71930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0854240.0AY085424.1 Arabidopsis thaliana clone 151034 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013649519.10.0PREDICTED: NAC domain-containing protein 30
RefseqXP_013649517.10.0PREDICTED: NAC domain-containing protein 30
SwissprotQ9C8W90.0NAC30_ARATH; NAC domain-containing protein 30
TrEMBLA0A078E5J00.0A0A078E5J0_BRANA; BnaA07g29730D protein
STRINGBra016098.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69502744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.10.0vascular related NAC-domain protein 7